Human neutrophil peptides induce interleukin-8 in intestinal epithelial cells through the P2 receptor and ERK1/2 signaling pathways
Antimicrobial Activity of Chimera Peptides Composed of Human Neutrophil Peptide 1 (HNP-1) Truncated Analogues and Bovine Lactoferrampin - ScienceDirect
Human neutrophil peptide 1-3,HNP1-3 ELISA Kit - Cusabio
2018-1447
Three-dimensional structures of human antimicrobial peptides. Notes:... | Download Scientific Diagram
HNP-1, a-Defensin-1, Human Neutrophil Peptide-1 - 0.1 mg
Human neutrophil peptide 1-3,HNP1-3 ELISA Kit, Cat#EKC34816 - Biomatik
IJMS | Free Full-Text | Meta-iAVP: A Sequence-Based Meta-Predictor for Improving the Prediction of Antiviral Peptides Using Effective Feature Representation
Human Neutrophil Peptide-1, NP-1 / HNNP-1 GENLISA™ ELISA | ARP American Research Products, Inc.
HNP-1, Defensin Human Neutrophil Peptide-1;ACYCRIPACIAGERRYGTCIYQGRLWAFCC(Disulfidebridge:2-30,4-19,9-29) 99287-08-8